PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03562.1.p
Common NameEUGRSUZ_K03562, LOC104426837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 275aa    MW: 31380 Da    PI: 5.1049
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03562.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd  l  +v+ +G g+W+++a   g++Rt+k+c++rw++yl
  Eucgr.K03562.1.p 15 KGPWTEEEDAVLRSYVETHGEGRWNSVAYFAGLRRTGKSCRLRWLNYL 62
                      79********************************************97 PP

2Myb_DNA-binding50.26e-1668111146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ + eE++++++++ ++G++ W++Ia++++ gRt++++k++w++
  Eucgr.K03562.1.p  68 RGNISLEEQLIILELHSRWGNR-WSKIAKHLP-GRTDNEIKNYWRT 111
                       78899*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0621066IPR017930Myb domain
SuperFamilySSF466891.09E-3112109IPR009057Homeodomain-like
SMARTSM007177.5E-161464IPR001005SANT/Myb domain
PfamPF002494.8E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231669IPR009057Homeodomain-like
CDDcd001671.53E-111762No hitNo description
SMARTSM007172.2E-1467115IPR001005SANT/Myb domain
PROSITE profilePS5129419.51467117IPR017930Myb domain
PfamPF002491.5E-1468111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2270116IPR009057Homeodomain-like
CDDcd001679.81E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MEIRSENEVL ADVKKGPWTE EEDAVLRSYV ETHGEGRWNS VAYFAGLRRT GKSCRLRWLN  60
YLRPQVRRGN ISLEEQLIIL ELHSRWGNRW SKIAKHLPGR TDNEIKNYWR TRVQKQAKQM  120
KCDVNSQQFR DTMRYEWMPR LAERIRAAEF KGQPACLPVS SSNDPIFDNR GVRMAELESG  180
WKDPSLMPEV SSGILSDSSD AQVSPVSGLT ESYNPPDGLT GGPGSGAGYS GWDMPGQEDM  240
MSSELFLDGG DSWDSLWNEE NVWFLRQQLS DDHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03562.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010038307.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-69MY108_ARATH; Transcription factor MYB108
TrEMBLA0A059A8Z40.0A0A059A8Z4_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s15970.16e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-75myb domain protein 78